SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011395 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011395
Domain Number 1 Region: 179-368
Classification Level Classification E-value
Superfamily Macro domain-like 4.12e-47
Family Macro domain 0.000000278
Further Details:      
 
Domain Number 2 Region: 13-116
Classification Level Classification E-value
Superfamily Histone-fold 4.56e-38
Family Nucleosome core histones 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011395   Gene: ENSAPLG00000011576   Transcript: ENSAPLT00000012121
Sequence length 372
Comment pep:novel scaffold:BGI_duck_1.0:KB745320.1:119039:138911:-1 gene:ENSAPLG00000011576 transcript:ENSAPLT00000012121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRSGKKKMSKLSRSSRAGVIFPVGRMMRYLKKGTYKYRIGVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKGRIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIQPELLAKKRGA
KGKSETILSPTPEKKGRKSMVSKKSGKKAKSNKARTPKKNKQKDNEKEGASNSTSEDGPG
DGFTILSSKSLVPGQKLSLTQSDISHIGSMKVEGIVHPTTAEIDLKEEIGKALEKAGGKE
FLETVKELRKSQGPLEVAEAALTQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLTA
AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLRAISTHFDGTSSSSLKNIYFLLFDSESIG
IYVQEMAKLDTK
Download sequence
Identical sequences R0JA86
ENSAPLP00000011395 XP_005030266.1.99704 XP_013028283.1.65836 XP_013028288.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]