SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000012185 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000012185
Domain Number 1 Region: 51-75
Classification Level Classification E-value
Superfamily Macro domain-like 0.0000175
Family Macro domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000012185   Gene: ENSAPLG00000012416   Transcript: ENSAPLT00000012919
Sequence length 77
Comment pep:novel scaffold:BGI_duck_1.0:KB743111.1:1339426:1359365:1 gene:ENSAPLG00000012416 transcript:ENSAPLT00000012919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERLLKMTLEERRKEYSREYVALKDIPTWMEEMKSKNESDGENAKEEQQGKKSLSEKVSLY
RGDITLLEVDAIVNAGR
Download sequence
Identical sequences U3IY59
ENSAPLP00000012185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]