SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013398 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013398
Domain Number 1 Region: 575-662
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.5e-18
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 32-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000117
Family PDI-like 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013398
Domain Number - Region: 714-794
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013398   Gene: ENSAPLG00000013560   Transcript: ENSAPLT00000014149
Sequence length 867
Comment pep:novel scaffold:BGI_duck_1.0:KB744498.1:27147:52019:-1 gene:ENSAPLG00000013560 transcript:ENSAPLT00000014149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRAKDVTMPAKLPMNFFSTRSPVIDLFRGQLDYADHLRQDSEIALYFFYAPWCGQSVAAR
EEIERVASRLSDQVLFVAINCWWNQGKCRKQKHFFYFPVIHLYHRSFGPIEYKGPMSAVY
IEKFVRRVMTPLLYISSRSKLLDFLSNYEPGVIGYFEFNASPQPPGYLTFFTSALHSLKK
DYLGTIRFGVITDKHVAEEISLVNSGSVYLHRHVNTSLIYPNDDMNYTAENICKWALENR
EMLIRWLRPHGGKSLLLNNELKKGPALLIFIPYNPLAEIHPLLDEITKVALEYYNCNKSQ
EAEPDPQHMGGNDSPAFDSYVPDAHTKLAETFSITKYPCCNTVVLPQWHSISRTHNVCEL
CINQTLGVKPNTVNVPHCNFFEIEAALDSFYLQEHTFFQVTSNTIECSNFLSFYSPFNYY
SACCRTVNRHFLSFISSEKTIFQTPKVVFSSHGKKDKDDIQNSIPHIEDRNCFIPHLHIS
GTNITGLSCRTNKTLNLYLLDSNLFWIYAERLGASRSTHLKEFAAIVDLKEEVHYVLDKN
QSLIGSTLENFIKNYSILYSPLKRHLVDDTSVRFRIQHVITEVTTSTFHDTVLSNEKNVL
LLYYAQWCGFCASLNHIFIQLARLLPPDNFTVARIDITRNDLPWEFMTDRLPTILFFPHH
RKEQSMKFPEDFSVNLPNLLKFILHYSSLSSSAPCTKECLHKETVLQQGHILHLEKEIQK
LRSEISALHQAHNHLEAQLSEAKREEHQVQQQKHILEKQHKTLQLHSEQLQATFDQKNRE
LLEMAEKLQELADASENLLKENTLLRILVASREGKLQGKDEINEALQPEQKLSDDNILVS
TATATSEEKRIDIDTLETEHSSKNRTE
Download sequence
Identical sequences R0KP04
ENSAPLP00000013398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]