SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014299 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014299
Domain Number 1 Region: 11-146
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-42
Family Ankyrin repeat 0.00024
Further Details:      
 
Domain Number 2 Region: 200-242
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000196
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014299   Gene: ENSAPLG00000014475   Transcript: ENSAPLT00000015075
Sequence length 245
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB752934.1:288:1552:-1 gene:ENSAPLG00000014475 transcript:ENSAPLT00000015075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADVNGMHGTLKPLHCACMVADADCVELLLQKGAEVNALDGYNRTALHYAAEKDETCVEI
LLEYGADPNALDGNKDTPLHWAAFKNMAECARSLLENGALVNARDYNDDTPLSWAAMKGN
LESVSVLLDFGAEVRVVNLKGQTPISRLVALLVRGLGTEREDSCFDLLHRAIGHFELRKN
GSMPWEVTRDQQLCQKLTLLCSAPGTLQTLSRYAVRRSLGVRFLPEAVEQLPLPTCLKEY
VLLLS
Download sequence
Identical sequences U3J472
ENSAPLP00000014299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]