SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014365 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014365
Domain Number 1 Region: 47-176
Classification Level Classification E-value
Superfamily Prefoldin 3.01e-27
Family Prefoldin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014365   Gene: ENSAPLG00000014527   Transcript: ENSAPLT00000015141
Sequence length 194
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743323.1:2472479:2478570:1 gene:ENSAPLG00000014527 transcript:ENSAPLT00000015141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAVVRGRGLQDSQGEGWGLCRGVKEIKEDVDSFMKQPGNETADVVLKKLDEQYQKYKFL
ELNLAQKKRRLKSQIPEIKQTLEILKHMQKKKESTNPMETRFLLADNLYCKASVPPTDKV
CLWLGANVMLEYDIDEAQALLEKNLSTATRNLDSLEEDLDFLRDQFTTTEVNMARVYNWD
VKRRNKEDPSKNKA
Download sequence
Identical sequences U3J4D8
ENSAPLP00000014365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]