SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014491 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014491
Domain Number 1 Region: 323-655
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.64e-70
Family Pancreatic carboxypeptidases 0.00000209
Further Details:      
 
Domain Number 2 Region: 147-308
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.47e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 655-738
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.57e-18
Family Carboxypeptidase regulatory domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014491   Gene: ENSAPLG00000014617   Transcript: ENSAPLT00000015269
Sequence length 768
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743453.1:203398:272354:1 gene:ENSAPLG00000014617 transcript:ENSAPLT00000015269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAFLACACPSVWLLCLALCAFGLLLLGDLSQAVPMDDQDYYLQEISNRDHYYSFPYPGEE
YFPFTEQPGEEGTIRAAQPEEHPGFKPSRKELKPKKSSKKGKSILETPPAKNGNNKKKGE
KNKRGNEKMPDGDSESQSAYEDIREAYCPPLGLETLKITDFQLHASTAKRYGLGAHRGRL
NIQAGVNENDFYDGAWCAGRNDPFQWIEVDARRLTKFTGVITQGRNSLWSSNWVTSYRVL
VSNDSHAWTAVKNESGDVIFEGNSEKEIPVLNMLPVPLVARYIRINPRSWYEEGSICMRL
EILGCPLPDPNNYYHRRNEMTTTDNLDFKHHNYKEMRQLMKTVNKMCPNITRIYNIGKSH
QGLKLYAVEISDNPGEHEVGEPEFRYIAGAHGNEVLGRELILLLMQFMCQEYLAGNPRIV
HLIEDTRIHLLPSVNPDGYDKAYKAGSELGGWSLGRWTQDGIDINNNFPDLNSLLWESED
QKKSKRKVPNHHIPIPDWYLSENATVAVETRAIIAWMEKIPFVLGGNLQGGELVVAYPYD
MVRSLWKTQDYTPTPDDHVFRWLAYSYASTHRLMTDARRRACHTEDFQKEDGTVNGASWH
TVAGSINDFSYLHTNCFELSIYVGCDKYPHESELPEEWENNRESLIVFMEQVHRGIKGIV
KDVHGRGIPNAIISVEGVNHDIRTGADGDYWRLLNPGEYVVGVKAEGYTGATKTCEVGYD
MGATQCDFTISKTNMARIKEIMRKFGKQPISLSLRRLRQRARQWRQRR
Download sequence
Identical sequences U3J4R4
ENSAPLP00000014491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]