SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014592 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014592
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-42
Family G proteins 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014592   Gene: ENSAPLG00000014743   Transcript: ENSAPLT00000015372
Sequence length 184
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743403.1:320041:323224:-1 gene:ENSAPLG00000014743 transcript:ENSAPLT00000015372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEG
FIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLTQLRQVSKEEGSALARE
FNCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVMAMEKKSKPKSSMWKRLKSPFRRKK
DSVT
Download sequence
Identical sequences U3J515
ENSAPLP00000014592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]