SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000756 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000756
Domain Number 1 Region: 217-466
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.63e-58
Family Voltage-gated potassium channels 0.00057
Further Details:      
 
Domain Number 2 Region: 91-188
Classification Level Classification E-value
Superfamily POZ domain 1.81e-25
Family Tetramerization domain of potassium channels 0.00000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000756   Gene: ENSAPLG00000001337   Transcript: ENSAPLT00000001327
Sequence length 516
Comment pep:novel scaffold:BGI_duck_1.0:KB745055.1:131078:132628:-1 gene:ENSAPLG00000001337 transcript:ENSAPLT00000001327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDVSSWKEMEVALVSFDNADQIVEDPCYSNDLSPAGQSRKGHPSCPNLLSNWRILINSE
NANNETIFSRFSAELSEHLVGERVGMEEGDQRVIINIAGLRFETRLKTLNQFPETLLGDP
EKRMRYFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDVFADEITFYELGDEA
MDQFREDEGFIKDPETLLPTNDFHRQFWLLFEYPESSSAARGVALVSVLVIVISIIIFCM
ETLPEFREEREFKSTQELSKNLTDTLLAHSTFTDPFFVIETACIVWFSFELFVRFIVCPS
KTDFFRNIMNIIDIVSIIPYFVTLTTELIQQSELNGQQNMSLAILRIIRLVRVFRIFKLS
RHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPQSHFSSIPDGFWWA
VVTMTTVGYGDMCPTTLGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQI
LPGEVERMLTSVVTGNGSMESLNKTNGGYPRDKAKK
Download sequence
Identical sequences R0KY04
ENSAPLP00000000756 XP_005029974.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]