SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000947 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000947
Domain Number 1 Region: 698-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 782-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000852
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 3 Region: 369-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000451
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 535-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000848
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 457-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000789
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 625-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000052
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 7 Region: 743-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000565
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 827-878
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000618
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000000947
Domain Number - Region: 48-162
Classification Level Classification E-value
Superfamily SET domain 0.000119
Family Histone lysine methyltransferases 0.049
Further Details:      
 
Domain Number - Region: 428-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00628
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number - Region: 191-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0172
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000947   Gene: ENSAPLG00000001239   Transcript: ENSAPLT00000001518
Sequence length 1139
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743889.1:194433:224588:-1 gene:ENSAPLG00000001239 transcript:ENSAPLT00000001518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGSDETMFIWCEDCGQYHDSECPELGPVVTVKDSFVLSRARSSLPSNLEIRQLEDGT
EGVFALTQLVKRTQFGPFESKRVAKLEKESVFPLKVFQKDGPLVYFDTSNEDDCNWMMMV
RPATEHKHQNLTAFQHDNDIYFTTSRDIPPGTELRVWYAAFYAKKMEKPVLKQVSSIANE
MNASESSGAAEAESSQWMCKVCSSAFQEPQLLTEHLLSHLEQAKGAPQASQNESVTEKAT
ETPPADPPVVCDAAGASTDSRRKARRGRKPKTAKAETPLIVVEEKDSAAERVASTATEVP
PDEVALPSATEERIMELVLGKMPSTTNSISSVTKFAHHQNTMSLKRSLILSSRHGIRRKL
IKQLGEHKRVYQCSICSKIFQNSSNLSRHIRSHGDKLFKCEECAKLFSRKESLKQHVSYK
HSRNEVDSEYRYKCTTCEKAFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKHKKK
HGDKKFACEICNKMFYRKDVMLDHQRRHLEGVRRVKREDFEHSTENMVRYKKEPSGCPVC
GKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQREEFI
GKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMDVHKEKGYGCSICNR
RFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHACE
QCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECKECHR
KFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKYVT
DYMLQKHIQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEILSVRIDDLEQLPETTT
IDASSIGIVQPELALEQSELPEGKQHMKAPKRGQKRKQKSGEEEEAQVPEDPAFSEYTEK
EAQFTGNVGDETNSAVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPITTAAGTQFTNLQ
PVAVGHLAAPERQLQLDNSILTVTFDTVSGSAMLHNRQNDIQIQPQPEAANPQSVAHFIN
LTTLVNSIAPLGNQITEQHPLTWRSVPQTDVLQPQAQPTPQQSGQQQVQTEQQQQMYSY
Download sequence
Identical sequences U3I127
ENSAPLP00000000947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]