SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001874 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001874
Domain Number 1 Region: 134-408
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.14e-70
Family Mitochondrial carrier 0.00018
Further Details:      
 
Domain Number 2 Region: 2-125
Classification Level Classification E-value
Superfamily EF-hand 1.23e-26
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001874   Gene: ENSAPLG00000002420   Transcript: ENSAPLT00000002452
Sequence length 417
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742955.1:76302:83717:1 gene:ENSAPLG00000002420 transcript:ENSAPLT00000002452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKIVKAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIVQSLRDLGV
KISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTV
PDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNNMCIIGGFTQ
MIREGGPRSLWRGNGINVLKIAPESAIKFMAYEQIKRFIGTDQEMLRIHERLSHDACSGP
EHPAPENDVAVLKTRMALRKTGQYSGMLDCAKNILSKEGMAAFYKGYIPNMLGIIPYAGI
DLAVYETLKNAWLQRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQAQASVE
GAPEVTMRGLFKHILKTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKMTLGVQSR
Download sequence
Identical sequences U3I3Q3
ENSAPLP00000001874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]