SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000001998 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000001998
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 95-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000001998
Domain Number - Region: 134-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0114
Family LDL receptor-like module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000001998   Gene: ENSAPLG00000002571   Transcript: ENSAPLT00000002579
Sequence length 176
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743201.1:136459:138345:-1 gene:ENSAPLG00000002571 transcript:ENSAPLT00000002579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPLCCPPRCVCVTSLLLLAATVAIVGLAVALGLPPRSPANRLCAASNNRTGFLCDDRVT
CIPASQVCDRTSNCRDGEDEQEELCGDLPRSLPTYLFFRCGNPAHWVYADKRCNGINDCG
DCSDEIGSLSACPPCGSAWWSCSPVFHEYCACVPRSLCRDSVQHCTSWSDEYLCTP
Download sequence
Identical sequences U3I427
ENSAPLP00000001998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]