SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002047 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002047
Domain Number 1 Region: 181-330
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 71-180
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-23
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 3 Region: 3-71
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.49e-16
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002047   Gene: ENSAPLG00000002547   Transcript: ENSAPLT00000002629
Sequence length 999
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743037.1:465287:551000:1 gene:ENSAPLG00000002547 transcript:ENSAPLT00000002629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVFQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWLQLDRRVLEHDFPKKSGPV
VLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIEVDSEVVFELAAYILQEAKGDF
SSNEVVRNELKKLPALPTPALKEHPSLAYCEDRVIEHYKKLNGQTRGQAIVNYMSIVESL
PTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIFQWRQLENLYFREKKFSVE
VHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQHQFYLDRKQSKSKIHAARS
LSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQESDSSQSAKKDMLAALKS
RQEALEETLRQRLEELKKLCLREAELTGKLPREYPLDPGEEPPIVRRRIGTAFKLDEQKI
LPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQRKTSYLNALKKLQEIENA
INEYRIKSGKKPTQRASLIIDEGNIASEDSSLSDALVLEDEDSQVTSTISPLQSPHKGLP
PRPPLHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESSLDEPYEKVKKRSSRSSHG
HASSHKRFPSTGSCAEAGGSSSLQNSPIRSLPHWNSQSSMPSTPDLRVRSPHYVHSTRSV
DISPTRLHSLAQHFRHRSSSLESQGKLLGSENETGSPDFYTPRTRSSNGSDPMDDCSSCT
SHSSSEHYYPAQMNPNYSTLAEDSPSKARERQRQRHKSAGNLVSSNSGSMPNLAARNGTG
HHRVYLHSQSQPSSQYRIKEYPLYIEGSSTPVVVRSLENDQEGHYSVKAQFKTSNSYTAG
GMFKENWHGDEADSVRLTPSRSQIIRTPSLGREGHEKGSGRTAVSDELRLWYQRSTASHK
EHSRLSHTSSTSSDSSSQYSTSSQSTFVAHSRVTRMPQMCKATSAALPHSQRSSTPSSEL
AATPPGSPHHILAWQTGEATDNSPTMDESQSPTHQSTDE
Download sequence
Identical sequences U3I476
ENSAPLP00000002047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]