SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002349 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002349
Domain Number 1 Region: 210-438
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.28e-58
Family Voltage-gated potassium channels 0.00069
Further Details:      
 
Domain Number 2 Region: 54-167
Classification Level Classification E-value
Superfamily POZ domain 2.41e-29
Family Tetramerization domain of potassium channels 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002349   Gene: ENSAPLG00000002909   Transcript: ENSAPLT00000002937
Sequence length 506
Comment pep:novel scaffold:BGI_duck_1.0:KB742649.1:349087:358073:1 gene:ENSAPLG00000002909 transcript:ENSAPLT00000002937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPPCCMSLSSQASLEEQGNSTSLGSLDSSVFSSEEEQGPLLQKAIPSLDCFTINVGGS
RFVMSQQTLSCYPDTRLGKLAVVVSAARDVASGLLELCDDANLVENEYFFDRSSQAFHYI
LNYYQTGRLHVMEQLCALSFLQEIQYWGLDELSIDSCCRDRYFRRKELSEALDIKKDAEE
LDAQDEEEDFSGSLCPNVRQKLWEVLEKPGSSAAARTFGTLSMAFVVVSIANMALISVEL
SWLAPPLLDALEYLCIAWFTVEFVLRFLCARDRCRFLRSVANIIDLLAILPFYITLLVES
LCGGESSQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTIAQCYEEVGLLLLFLS
VGISIFSTVEYFVEQGVPGTTFTSVPGAWWWATTSMTTVGYGDIRPDTTIGKVVAFMCIL
SGILVLALPIAIINDRFSACYFTLKIKEAALRQREALKRLTKNSSSDSNINVNLRDIYAR
SVMDMLRLKSRERASTRSSGGDDFWF
Download sequence
Identical sequences R0LW58
XP_005013227.1.99704 ENSAPLP00000002349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]