SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003672 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003672
Domain Number 1 Region: 274-302,330-528
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-60
Family Voltage-gated potassium channels 0.00048
Further Details:      
 
Domain Number 2 Region: 147-244
Classification Level Classification E-value
Superfamily POZ domain 9.68e-27
Family Tetramerization domain of potassium channels 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003672   Gene: ENSAPLG00000004176   Transcript: ENSAPLT00000004276
Sequence length 617
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743317.1:1054547:1056535:-1 gene:ENSAPLG00000004176 transcript:ENSAPLT00000004276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSADSSGCNSHMPYGYAVQARARERGGGGPYHHYHQEQSRGASSSHGGNASRSSL
PNRQSGKRWKKGKKRSHHLGSRECGASFPCSELLPLSGSEERILKDLMYYGADYGEDEFS
YSDQPPDDGGGPGGYSSVRYSEYECCERVVINVSGLRFETQLKTLAQFPETLLGDPAKRG
RYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLKRPVNVPFDIFSEEVKFYQLGEEAMLKF
REDEGFVKEEEDKALPENEFKRQVWLLFEYPESSSPARGIAIVSVLVILISIVIFCLETL
PEFRDDKEFVMSLSLGKGLSNESLHLDAGEHTIFNDPFFIVETVCIIWFSFEFTVRCFAC
PSKAHFFKNIMNIIDIVSILPYFITLGTDLAQEQGSNGQQAMSFAILRIIRLVRVFRIFK
LSRHSKGLQILGHTLRASMRELGLLIFFLFIGVILFSSAVYFAEADEPATHFQSIPDAFW
WAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQ
TQLMQNAVSCPYLPTNLLKKFRSASSSSTEDKSEYLEMEEGVKESLCVKEKKSQDTGNSS
ESEKKNCVNSNSVETDV
Download sequence
Identical sequences U3I8V1
ENSAPLP00000003672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]