SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004193 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004193
Domain Number 1 Region: 2-273
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.97e-60
Family Pancreatic carboxypeptidases 0.00000149
Further Details:      
 
Domain Number 2 Region: 273-369
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.26e-22
Family Carboxypeptidase regulatory domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004193   Gene: ENSAPLG00000004644   Transcript: ENSAPLT00000004802
Sequence length 374
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742853.1:3340461:3359605:1 gene:ENSAPLG00000004644 transcript:ENSAPLT00000004802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPEFKYVGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIINLIHSTRIHIMPSLNPDGF
EKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKAVDQN
PKLAPETKGVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSCPDDAIFQSLA
RSYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVE
LSCEKFPPEETLKGYWEDNKNSLINYIEQIHRGVKGFVKDLQGNPIANATISVEGISHDI
TSAKDGDYWRLLVPGNYKLTASAPGYLAITKKVAVPFSPAVMVDFELESLSERKEEEKEE
LMEWWKMMSETLNF
Download sequence
Identical sequences U3IAC2
ENSAPLP00000004193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]