SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004674 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004674
Domain Number 1 Region: 184-307
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.05e-59
Family Dystroglycan, domain 2 0.000000571
Further Details:      
 
Domain Number 2 Region: 501-603
Classification Level Classification E-value
Superfamily Cadherin-like 4.24e-17
Family Dystroglycan, N-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 64-162
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000298
Family Dystroglycan, N-terminal domain 0.0000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004674   Gene: ENSAPLG00000005117   Transcript: ENSAPLT00000005292
Sequence length 869
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743544.1:292008:304084:1 gene:ENSAPLG00000005117 transcript:ENSAPLT00000005292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMTVGCVLQPPVLGRTLLPVLLLLLAASAHCHWPSEPAEVVRDWENQLEASMHSVLSDLR
ETVPAVVGIPDSSAVVGRFFRVSIPTDLIASNGEVVQISEAGKESLPSWLHWNAESSSLE
GLPLDTDKGVHYISVATLQPFPNGSYVPQTTNVFSVEVHQEDHNEPQSVRVAAQDTGEAA
PFVCGAEEPVTVLTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNKLFDM
SAFMAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWH
IANKKPHLPKRMRRQINATPTPLTAVGPPTTAAQEPPTRIVPTPTSPAIAPPTETTAPPV
REPIPLPRKPTVTIRTRGPIVQTPTLGPIQPTRVIEGTGTASVPIRPTMPGYVEPTAVIT
PPTTTTKKPRVSTVKPATPSTTDSSTVTTRRPTRRPKTPRPTKPPSTTRSPISKLTTASP
PSRVRTTASGIPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQL
TLKLKEQQMLEENSWVQFNSTSQLMYGMPDHNHIGKHEYFMYATDKGGLFAVDAFEIHVH
KRPHGDKSPVKFKARLEGDHNAVVNDINKKILLVKKLALAFGDRNSSTITVQDIAKGSIV
VEWTNNTLPVEPCPREQIRTLSKKIAXDSGGPSLAFSNILQPEFKPLNVSVVGSGSCRHI
QFIPVTKDGRVISEATPTLAAGKDPEKSSEDDVYLHTVIPVVAAILLVAGIIAMICYRKK
RKGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPQHPNQQSMP
ETTPLNQDTIGEYTPLRDEDPNAPPYXPP
Download sequence
Identical sequences U3IBQ2
ENSAPLP00000004674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]