SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004964 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004964
Domain Number 1 Region: 10-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 2.35e-67
Family TRADD, N-terminal domain 0.0000053
Further Details:      
 
Domain Number 2 Region: 207-299
Classification Level Classification E-value
Superfamily DEATH domain 3.06e-16
Family DEATH domain, DD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004964   Gene: ENSAPLG00000005392   Transcript: ENSAPLT00000005588
Sequence length 304
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743829.1:1072476:1080797:1 gene:ENSAPLG00000005392 transcript:ENSAPLT00000005588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLKMAGSSAPWIGSAYLFLQSTCKTIALPSLYESSQKKPSVFKALKLALADSTGSVNGVD
MLKVHCSHPHLIVQLKFCKQENCRRFLQSYREGVLQESLQNHLQLALAMTTVPLEMELKA
GNEHLDNMLKDEDRCLECIYREKPDRLRDEEITELEEYLQSLILHQNINNNLPAKDCASL
NPPSLPSHGSSPSPQVTFLFQGQQFANRTLTPDDHQKFAKLVSKKWKQVGRSLQRNCRAL
RDPVIDNLALEYDREGLYEQAYQLLLRFIQSEGKKATIARLIAALEENGLTSLAEELLGL
HSHE
Download sequence
Identical sequences U3ICJ2
ENSAPLP00000004964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]