SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005926 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005926
Domain Number 1 Region: 370-503
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-32
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 2 Region: 223-357
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1255-1386
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-30
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1121-1241
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-27
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 5 Region: 514-648
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-26
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 6 Region: 816-942
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-26
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 7 Region: 666-813
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-25
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 8 Region: 959-1105
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-23
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 9 Region: 36-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.29e-23
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 10 Region: 162-218
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-18
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005926   Gene: ENSAPLG00000006239   Transcript: ENSAPLT00000006562
Sequence length 1466
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744072.1:257907:295572:-1 gene:ENSAPLG00000006239 transcript:ENSAPLT00000006562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLSCFLLLMLLHGRHHGCKQRSLAVPPESILQNTDKGIFIIQSSDSNLCIKVDPAGLVL
EDCSQLSKYMLWKWVSNRRLFNIGSSTCLGLNISRPEQPLTMLECDSTQYSLWWNCDGRA
LVGVSEYKLAIENSKRIVAKKNSNYEWTQYMSYDEDLCELPFQETYTLLGNSFGFPCVFP
FKYNNKWYYECTRDGREFDWCATTSYYEQDEKWGFCPNAERAESGCDAFWKKNPATNLCY
QFNVASVLSWHEARAACQMQGGDLLSITSLEEQSYIMKRDHLNATDIVLWTGLNRLGEDT
GWQWSDGAPLMFVNWRANVSDDRFTENHCVVINSKLKYGWQSYLCESGLPFVCKKYLSKT
EHETFVKDTWKYYATRCDAGWYPHNRNCYRLHKEEKSWNDALISCQSDNSRLISISSMAD
AELLRNLLERENVTETWIGLYSNNTPVVFKWSDSTPVKLSNWHSQEPNTFQRTGQLCVSA
QGPEGHWKVKKCEDGSFYVCKKAGEFNNVSSEMESSCPEGWERHGGYCYKIDSTPRSFEH
ASSGYFCPSALVSVTNRFEQAFITSMIHSMVKSERTYFWIGLQDLNNTGEYFWLTTDGKN
HSVSYANWNKHQPRHSGGCVAMRGENPVGYWEVKSCRNFKAMSLCKQKINSYEEPELTFQ
RHLSSCYFGWESEANLFNCYKIFHSEKVLMKRTWDEAETLCQDFGAHLASFSHIYEETFL
NNLLYTIFDRTEERQFWIGFNKRNPLSGGTWQWSDRTPVVSSFLESKYVEDDSRNCGVFK
VNKTVFPAHCNEKREWICKIPKGVKPKNPDWYIAELPWSYYQGAEYLFHVNPTDWDTYEF
ICGWLRSGMATINSSGEQAFIENKIKKLSNSDVHWWIGLHAENASNEFRWRDESLVTYQN
WNEGREQDLHKPGKRCGFISSQTGLWGDENCTVSLPCICKRKIAWKIEKEIPKDQNQQGI
CPKGWLHFGFKKQCFLIQIPKDPDHLRSWYSAQAFCSRYDGSLASLEDELEQAFITMNLF
GRKTSVWIGFQSDDYEKWVNENPPMYSNWSPIQAVHRQRYNSANVEEQVPLCTLVSNSPN
FYFTGKWYLENCEKNYGFVCQKKQDTSRHVINASEMYPVPDTLEYANRTYNLIRGNFTWS
GALKTCMANGAELVSIADQYHQAFLTVIVNRLGYNHWIGLFTADNGLNFEWSDGTRSLFT
FWEDDESQAFGSCVYMDTSGHWKSANCERLLQGAVCHVPPKKKLTDYKGLCSEKTVPWIK
FKNSCYSFTTVLQGTSFDTAYEVCRNQGSNLLTIQDEDENTFILEELHSLGYSVQMVWLN
ILHVTDNETVSWSDGSPLNYSNWGIREPEFDHLKGNFCISLRTTDGIWQISPCREKKGFV
CKMDADIDATAPSEKSSYPGLAALAVLVTLVMLAAISIFLWCLYKQNNRLFSRILWIRNA
YFPQINADVPALEESILISDFERDDN
Download sequence
Identical sequences U3IFA4
ENSAPLP00000005926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]