SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006968 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006968
Domain Number 1 Region: 171-313
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-35
Family Third domain of FERM 0.0047
Further Details:      
 
Domain Number 2 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 1.14e-32
Family Second domain of FERM 0.0000837
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.8e-21
Family First domain of FERM 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006968   Gene: ENSAPLG00000007330   Transcript: ENSAPLT00000007619
Sequence length 539
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742410.1:170536:184201:-1 gene:ENSAPLG00000007330 transcript:ENSAPLT00000007619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQMRAQPPFTMCF
RVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGK
HPEGYSSKFQFFPKHSEKLERKIAEIHKSELSGQTPATSELNFLRKAQTLETYGVDPHPC
KSGCGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKMKFEGKTFYLYVSQKEEKKIVLTY
FAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGRVAKEVMESSA
KIKREPPEIHRAGLVPSRSCPSITHGPRLSSVPRTRRRAVHISIMEGRTRGERGDTASTA
LHTHTGTQKSRCTPKCTSRRLQQGEAVGAMGCSPHVPQCFAPTLRWGHRVVPGVLRGERA
VLGGCPVPSEAGTPSAAEAEEPGELRALCLGAGGHGGTRAEQVNKFVLSVLRLLLVTVGL
LFVLLLLLIVLTESDLDTAFFRDIRQTPEFEQFHYQYFCPLRRWFACKVRAVVSLLIDT
Download sequence
Identical sequences U3II96
ENSAPLP00000006968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]