SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007078 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007078
Domain Number 1 Region: 219-459
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.06e-49
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-176
Classification Level Classification E-value
Superfamily POZ domain 3.66e-28
Family Tetramerization domain of potassium channels 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007078   Gene: ENSAPLG00000007454   Transcript: ENSAPLT00000007732
Sequence length 508
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742479.1:4677132:4679155:1 gene:ENSAPLG00000007454 transcript:ENSAPLT00000007732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLPGENSDYDYSALSCASDTSFNHTFFPETETLKGVFYQRAKLIHPEEDLLKGFHPDD
RKHHIIINVGGIKYLLPWTTLDEFPLTRLGQLKFCNNFDDILNICDDYDVTCNEFFFDRN
PGAFRTILTFLRVGKLRLLREMCALSFQEELLYWGIEEDNLDWCCKRRYLQKMEELTEIN
EREDDLIENETGETLEETKIGLCMRKLQDMVERPQSGLPGKVFACLSVLFVTITAVNLSI
STMPDLREEEEKGECSQMCYNIFIVESVCVAWFSLEFLLRFIQAKSKFAFLRRPLTLIDI
IAILPYYITLLVDTTSVGYKKPSSGSIYLDKVGLVLRILRALRILYVMRLARHSLGLQTL
GLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSQEFTSIPACYWWAVITMTTVG
YGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERIMYRRAQFLL
KTKSQISNASQGSDILFPSLSSETRENE
Download sequence
Identical sequences U3IIK6
XP_005010538.1.99704 XP_012961090.1.99704 XP_012961095.1.99704 ENSAPLP00000007078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]