SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007386 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007386
Domain Number 1 Region: 726-1078
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.7e-54
Family Ankyrin repeat 0.0000428
Further Details:      
 
Domain Number 2 Region: 454-712
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-48
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 3 Region: 221-410,441-522
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-44
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 49-157
Classification Level Classification E-value
Superfamily POZ domain 2.93e-21
Family BTB/POZ domain 0.0068
Further Details:      
 
Domain Number 5 Region: 1103-1162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007386   Gene: ENSAPLG00000007717   Transcript: ENSAPLT00000008048
Sequence length 1168
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744160.1:251724:276394:-1 gene:ENSAPLG00000007717 transcript:ENSAPLT00000008048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAEEVAKLEKHLMLLRQEYVKLQKKLADTERRCNLLAAQANQDNASDTFISRLLAIVSE
LYQQEQYSDLKIKVKDKHIRAHKFVLAARSDAWSLANLASTEELDLSDADPEVTMAMLRW
IYTDELELREDDIFLTELMKLANKFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLLNYCAEIIASHWDDLRKEDFSSMSAQLLYKMFKSKTEYPLHKAIKVEREDVVFLYLIE
MDSQLPGKLNELDQNGDLALDLALSQRLESIATTLVNYKADVDRADKKGWSLLHKAIQRE
GDKFAANFLIKNGARVNAATLGDQETPLHLVASYSPKKHLPDVMAEMAQIAESLLQAGAN
PNMQDSKGRTPLHVSVVVRNEPVFSQLLQCKQLDLELKDHEGSTALWLAVQYITVSSDQS
VNPFEDAPVVNGTSFDENSFAARLIQRGSNTDAPDTVTGNCLLQRAAGAGNEAASLFLAT
HGAKVNHQNKWGETPLHTACRHGLANLTAELLQQGANPNIQTAEAAHGQKDASSPTAENV
YLQTPLHMAIAHNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGM
HTIAAQLLGSGASINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQL
AIKNQLPLVVDAICTRGADMSVPDEKGNPPLWLALENNLEDIASTLVRHGCDSTCWGSGP
SGCLQTLLHRAIDENSEQIACFLIRSGCDVNSPRKPGPNGEGEEEAHDGQTPLHLAACWG
LEEVIQCLLEFGANVNAQDAEGRTPIHVAISNQHNVIIQLMISHPEIKLNVRDRQGMTPF
ACAMTYKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRV
QDASKLTPLHLAVQAGSEIIVRNLLLAGAQVNELTKHRQTALHLAAQQDLPTICSVLLEN
GVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECNVDAEAFNVRGQSPMHILGQYGKDNA
AAICDLFLECMPEYPLDKPDAEGNTVLLLAYMKGNANLCRAIVRAGARLGVNNNQGVNIF
NYQVATKQLLFRLLDMLTKEPPWCDGSNCYECTAKFGVTTRKHHCRHCGRLLCHKCSTKE
IPIIKFDLNKPVRVCNICFDVLTLGGVS
Download sequence
Identical sequences U3IJG4
ENSAPLP00000007386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]