SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008307 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008307
Domain Number 1 Region: 226-470
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.31e-87
Family Eukaryotic proteases 0.0000546
Further Details:      
 
Domain Number 2 Region: 126-232
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.065
Further Details:      
 
Domain Number 3 Region: 92-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008307   Gene: ENSAPLG00000008634   Transcript: ENSAPLT00000008983
Sequence length 475
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745737.1:175745:188603:1 gene:ENSAPLG00000008634 transcript:ENSAPLT00000008983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLLLIQAQETNPTTGSLEIISVAEDEPPVPEIHFSFKRFFSIQVRVDPSADGSDIEPPS
MCHVLISPKYLPYVCVTSLLVILAVAIGLGVQYNCIGKFRCQSSFKCIQKSARCNGVFNC
KEGEDEYGCVRLSGKRAVLQVFTSGSWRTVCSDDWKAEYGNTTCKHLGFSSYVSSGYLPV
TAVEKQFQRHFVSLSHWLSADQVTSLHNATNLREECTSGNVIVLKCLACGTRASYGPRIV
GGNASSPRQWPWQVSLQFHGHHLCGGSVITPRWIVTAAHCVYDLYLPSSWSVQVGFVTQQ
DTQVHPYSVEKIIYHRNYKPKTMGNDIALMKLAAPLVLNGHIEPICLPNFGEQFPEGKMC
WVSGWGATVEGGDTSDTMNYAGVPLISNAICNHRDVYGGIITPSMLCAGFLKGGVDTCQG
DSGGPLACEDMSIWKLVGTTSFGVGCAEENKPGVYSRTTSFLDWIHEQMEHQDKT
Download sequence
Identical sequences U3IM35
ENSAPLP00000008307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]