SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009312 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009312
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-24
Family SH2 domain 0.00076
Further Details:      
 
Domain Number 2 Region: 113-143
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000157
Family SOCS box-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009312   Gene: ENSAPLG00000009601   Transcript: ENSAPLT00000010002
Sequence length 145
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743461.1:211544:220821:-1 gene:ENSAPLG00000009601 transcript:ENSAPLT00000010002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSL
WCHPKFEDRCQSVVEFIKRAIMHSKNAAFPPPVSGLPPTPVQLLYPVSRFSNVKSLQHLC
RFRIRQLVRIDHIPELPLPKVLRIL
Download sequence
Identical sequences U3IPY9
ENSAPLP00000009312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]