SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009701 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009701
Domain Number 1 Region: 32-121
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0024
Further Details:      
 
Domain Number 2 Region: 132-193
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 
Domain Number 3 Region: 1-29
Classification Level Classification E-value
Superfamily SRCR-like 0.000000209
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009701   Gene: ENSAPLG00000009996   Transcript: ENSAPLT00000010398
Sequence length 194
Comment pep:novel scaffold:BGI_duck_1.0:KB745096.1:1:1153:1 gene:ENSAPLG00000009996 transcript:ENSAPLT00000010398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EATLQDCPHYGWGKHFCNHDRDVGVTCTGFSRLAGGDGACSGRLEVRQGRAWATVCHGHV
DLKAAQVVCRELGCGTAVAVPAAGHFGAATGPLWDGAFECNGSEPLLASCARRPTHGQAC
AAPQRPLCAAAYTGFRLADGGSGCAGRVEVEAQGTWGALCASAWDLRDAHVLCRHLGCGP
AASLPPGGHFGTGT
Download sequence
Identical sequences U3IR28
ENSAPLP00000009701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]