SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009705 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009705
Domain Number 1 Region: 2-108
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00028
Further Details:      
 
Domain Number 2 Region: 110-210
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 3 Region: 206-291
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009705   Gene: ENSAPLG00000009996   Transcript: ENSAPLT00000010402
Sequence length 291
Comment pep:novel scaffold:BGI_duck_1.0:KB745096.1:157:1433:1 gene:ENSAPLG00000009996 transcript:ENSAPLT00000010402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEALELRLAAGRGPCEGRVEVKLRGRWGTVADDAWDTEDAEVVCQQMGCGSVADIYKGSN
FGRADGPLSLALVDCDGTEKALWDCKIQGWGPYEGPHEYDSTVVCQGFSRLAGGDGACSG
RLEVRQGRAWATVCHGHVDLKAAQVVCRELGCGTAVAVPAAGHFGAATGPLWDGAFECNG
SEPLLASCARRPTHGQACAGPAAIVCSPYTGFRLADGGSGCAGRVEVEAQGTWGALCASA
WDLRDAHVLCRHLGCGPAASLPPGGHFGTGSGPVELQELRCAGSEELLAQC
Download sequence
Identical sequences U3IR32
ENSAPLP00000009705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]