SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009888 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009888
Domain Number 1 Region: 606-670,708-807
Classification Level Classification E-value
Superfamily PH domain-like 5.39e-33
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 1224-1357
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-19
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number 3 Region: 819-932
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000009888
Domain Number - Region: 1126-1205
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000272
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 27-120,713-733
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00115
Family BAR domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009888   Gene: ENSAPLG00000010128   Transcript: ENSAPLT00000010589
Sequence length 1500
Comment pep:novel scaffold:BGI_duck_1.0:KB742781.1:1106745:1156636:-1 gene:ENSAPLG00000010128 transcript:ENSAPLT00000010589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSEPEGTVNWKERCLTLESQLMKFRLQASKIRELLAEKMQQLERQVIDADRQAERAF
QQVQVMEEKLKAANVQTSESENRLYKRCQDLEILIQDKNDIIQKLEQQLEEQKQIRLQEA
KLIEEKAAKIKEWVTVKLHELEVENQNLRLINQKQTKEMKTVQSKLQEATGKKSVTSTQK
PGECQRLSSLTFGCFSNRARSPQPSPKFEEISKSSSKESDYTEGKNTLEKDILETTFAGP
AHESNKGQKSLQQSSSGSEQNKNVRTSCSSKDLDSDMSKNSCTTGSDWSSDEDGGDNKGM
KSRCASTLSSHTSEENTRYSRVGSEMYLTASDDSSSLFEEESLGVQRTQHKKLYSWQQGS
QRKGQNNPGGKCNSDFTSKKKDQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALT
PKHPILATSAGSQYPTLSDSPSNLPPPKLRTPNVFSINSALAKKHLSQPQLSSDRMFGKN
RNAISMIRPWRPQETDIDLVDGEDTGILEKMEIGCDEGVFTYDCTEVQNAEAQEPCDTTK
KAASNKPPTPPLHRFPSWESRIYAVAKSGLRMSEAFTVESLNKSAVSLTSYSVSGLYTSL
IYKNMTTPVYTTLKGKATQISNSPFIDESSGSEEEDSSRSSSRTSESDSRSRSGPSSPRA
MKRGVSLSSMTSESDYAIPPDAYSVDTDCSEPEQKLPKTSSSSTDNGKNEPLEKSGYLLK
MGGKVKTWKRRWFVLKGGELLYYKSPSDVIRKPQGQIELNASSHIERGDGKQTIQLTTEK
RTYYLTADSPNILEEWIKVLQNVLKIQAASPLFIQPEIKPTMKGLLTKVKHGYSKRVWCT
LVGKILYYFRNQEDKFPLGQIKLFEAKVEEVDRSCDSDEDYEASGRSLLSTHYTVVIHPK
DQGPTYLLIGSKHEKDTWLYHLTVAAGSTNVNVGSEFEQLICKLLNMEGDTTSQVWRHPT
LCHSKEGIASPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHVSLAQSALQICLT
HPELQNEICCQLIKQTRRRHPQNQTGPIQGLQLLALCVGLFLPQHPFLWLLKLHLKKNAD
SRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIY
QVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFSDDPSGKDIEHCLQGNIKICDIISK
WEQASKEQHPGKCEGTRTVRLTYKNRLYFSVQVHGETDREKLLLVYQTNDQIVNGLFPVN
KELAMELTALLAQVEIGDFERPFSTPAGQVTSQSKSNQTLKQVLERFYPKRYRHGCSEEQ
LRQLCQRLSTRWMALRGHSAADCVRIYLTVARKWSFFGAKLFAAKPLATSTLEKSFIWFA
VHEDGISILDYSTMRLTVTYTYKSLMTFGGYQDDFMLVVNDAQMKDKATEKLLFAMTKPK
ILEITLLIASYINNFHQQKGAAHHLSAPALLTPQSGQKFKELGSQPLLTNNRPTKCPTLL
Download sequence
Identical sequences R0K379
ENSAPLP00000009888 XP_005015339.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]