SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010821 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010821
Domain Number 1 Region: 199-347
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-38
Family Third domain of FERM 0.00052
Further Details:      
 
Domain Number 2 Region: 97-201
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-33
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 3 Region: 24-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family First domain of FERM 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010821   Gene: ENSAPLG00000011064   Transcript: ENSAPLT00000011539
Sequence length 695
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743697.1:29122:124296:-1 gene:ENSAPLG00000011064 transcript:ENSAPLT00000011539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMINAATAEKAKLNTHSYKTNKPKTLSFLLQKHAKGQELFDQIVYHLDLVETDYFGLQFM
DASQITHWLDHSKFIKKQIKIGPPYTLHFRIKYYSSEPNNLHEEFTRYLFVLQLRQDILS
GKLKCPYETAVELAALCLQAELGECEHPEHTPELVSEFRFAPNQTEAMEFDIFQKWKECR
GKSPAQAELCYLNKAKWLEMYGVDMHVVKGRDGCEYALGLTPTGILIFEGANKIGLFFWP
KITKMDFKKSKLTLVVVEDDEQGREQEHTFVFRLDSAKTCKHLWKCAVEHHAFFRLRAPA
NSKSSRSDFIRLGSRFRFSLSGRTEYQATHGTRLRRTSTFERRPSKRYPSRRHSTFKANN
PVKAAQLWVTVQVLFTYQPQYHPNIHPAQPHWHPHTPVNVSYPLNNSDLHQFNIEENGGT
PYSAKIPARHHHHHRHHHHHSNYGALAPDSKDIVSGVPNPNILGIFLELSSGLPLLFDET
SHLKKIETESVKVVGPWPPLHVSMNKGEEKKVPEKTLHAPVSPSSVPDHMKCNILKAQVE
AAFRVGTQAVKEETSFVNPSKTSSLQDPNVRSPAPVRPETTPSTGPTEKQEIKVSRVRKL
TRQYSFDEDDLPPALAAAAAASTSVSSASPGSQKTCTPQTSEGQTQVSPGGKSSTDAGST
FALEPGDLLMDFTEATPMYSTCSGHCSQYMGCNKP
Download sequence
Identical sequences U3IU98
ENSAPLP00000010821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]