SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011123 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011123
Domain Number 1 Region: 230-463
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-52
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 71-182
Classification Level Classification E-value
Superfamily POZ domain 4.97e-26
Family Tetramerization domain of potassium channels 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011123   Gene: ENSAPLG00000011387   Transcript: ENSAPLT00000011845
Sequence length 499
Comment pep:novel scaffold:BGI_duck_1.0:KB744134.1:122336:125740:1 gene:ENSAPLG00000011387 transcript:ENSAPLT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRQLERRRVSLSAGLKIGDRRGCCRTLEEEDVHIPFAQESLVKQWRSMQNVTDSNQEKN
EMPLQRSKYFLNINVGGTLFHIACKAAARYPVTRLGKLAIYTDPTKKLQLCDDYSVQKNE
YFFDRDPSIFHYIFHFYRSGVLWIRDEMCPSNFVEEIEYWGVHLKYSQRCCRILFEEKQD
ELSENLKIQKELEAELEPLESAEQFEGKCLGQFRKMIWNLIENPYSSVPAKIIAVMSSLF
VLISIVGMTLSTVEEMQHKTAKQWMELLEMVCAIFFTSEYLMRLISSSSFKKFLRAALNA
VDLVAILPFYIQILFENLDEGDTLYHEELHQMENVSKLGKVLKLIKLMRIFRILKLARHS
TGLRAFGFTMRQCYQQVCCLLLFIAMGVFTFSALMHSVEHDVPGTNFTSIPYAWWWAAVS
LSTVGYGDTVPDTVLGRVVAFGCISFGIILNGMPISILYNKFSDYYAKLKAHENETSLSL
KLSRRFRFKERALRKLSEC
Download sequence
Identical sequences U3IV50
ENSAPLP00000011123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]