SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011294 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011294
Domain Number 1 Region: 191-429
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.18e-81
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000196
Family Hepsin, N-terminal domain 0.055
Further Details:      
 
Domain Number 3 Region: 55-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011294   Gene: ENSAPLG00000011505   Transcript: ENSAPLT00000012018
Sequence length 434
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742431.1:95752:98973:-1 gene:ENSAPLG00000011505 transcript:ENSAPLT00000012018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRAGPPNSALQVPAPDPKPARSVRRFCMRVGIPVLVVVLSLACLAGIGLLVKAYLEYHY
FFCKQPLRLLPLARVCDGEADCLHGEDEASCPQHVPEGPQAGARVSRDRSILQVLNRNTG
AWSCVCYDHFNLALAKAACEQMGYSSTPSFRAVDAGAGQPLPPREPCCCSEPSPFPPSSR
KCLSGSVVSLVCSSCGESARTPRVLGGRPAAIEWWPWQVSLQYRTEHICGGSVIEPGWIL
TAAHCFKNNPVIPNWRVKAGSDLLSGSVTLAVEKVFLAEVTPPSPKDNDIALVKLQSPLQ
VSDRIKPICLPYFDEELVPGTSLWVTGWGYTKEHGKLSETLQQAEVKLVDTTSCNLAAYH
GEVTEKMLCAGVPQGGVDTCQGDSGGPLMYLGRHWQVVGIVSWGQGCGTPSTPGVYTSVR
AYLNWIYAVRRVSA
Download sequence
Identical sequences U3IVM0
ENSAPLP00000011294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]