SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011396 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011396
Domain Number 1 Region: 192-290
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00046
Further Details:      
 
Domain Number 2 Region: 55-167
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011396   Gene: ENSAPLG00000011633   Transcript: ENSAPLT00000012122
Sequence length 300
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744431.1:78694:80555:-1 gene:ENSAPLG00000011633 transcript:ENSAPLT00000012122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHHGEDTGVVCSGQRLHSGPDTAAAPGLLGEAPGLSLEEVRIKPILARAKLSMPVTEGAV
EVKHNGRWRQVCDAGWTRNNSRVVCGMLGFPQEKHVNTSFYRKLWNMKLKDPSSSLKNLS
QKSSFWVHQVQCQGTEPHLARCPTQLAPPAPRQLCLSPSVSCIPGPAFQQGKGRGKKPPC
KASQGKAPPLHRLRAGAHIGEGRVEVLRHGQWGTVCDKRWDLAAASVVCRQLGYGAKQAL
VGARMGQGEAGGGVRNWGAAGLRDSLGECRFQDAEQSGCRHEDDAAVRCHVPHMDFQSQV
Download sequence
Identical sequences U3IVX1
ENSAPLP00000011396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]