SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011861 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011861
Domain Number 1 Region: 233-500
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-66
Family Nuclear receptor ligand-binding domain 0.000000000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011861   Gene: ENSAPLG00000012071   Transcript: ENSAPLT00000012593
Sequence length 502
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742462.1:1445380:1448648:-1 gene:ENSAPLG00000012071 transcript:ENSAPLT00000012593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYNTSYDVKPPCLYQMPLSGQQSSIKVEDIQMHSYQQHGHLPPQSEEMMSHSGSV
YYKPSSPPTPSTPGFQVQHGPMWDDPGSLHNFHPNYVATTHMIEQRKTPVSRDWPGQGAV
CELTEWNRIPCGQIKGGLQGIASPSLLLAYKTLLGAAGLAQMWLSTASLAVVRTDSLKGR
RGRLPSKPKSPQEPSPASPRAGRPWLQPARKRRFAYLKQRPRSTVPKNFQFQANPDYQMS
GDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFTDLPKTDQDLLFESAFLELFVLRLAYRSN
PVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERH
GLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYL
KLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences U3IX85
ENSAPLP00000011861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]