SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013357 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013357
Domain Number 1 Region: 37-281
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.41e-56
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 279-321
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000034
Family SOCS box-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013357   Gene: ENSAPLG00000013543   Transcript: ENSAPLT00000014107
Sequence length 322
Comment pep:novel scaffold:BGI_duck_1.0:KB742774.1:1290876:1303169:-1 gene:ENSAPLG00000013543 transcript:ENSAPLT00000014107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSSILHAFTNIYFAIFALFCFKLLIKISLALLTHFYIVKGNRKEAARIAEEIYGIVPG
SWADRSPLHDAAFQGRLLSLKTLIAQGFNVNLVTTDRVSALHEACLGGHVACAKLLLENG
AQVNAATIDGITPLFNACCSGSVACVNMLLEFGAKPQLGSHLASPIHEAVKRGHRECMEV
LLAHKVDIDQEDLQHGTPLYVACTYQRTDCVKKLLELGANVNAGKRLDSPLHAAARKSSV
EIVVLLADYGANLKGRNADFKCALDLAVPNSKIEQALLLREGPASLGQLCRLCIRKHLGR
SCLYAVPKLHLPEPLENFLLYR
Download sequence
Identical sequences R0K4C9
ENSAPLP00000013357 XP_005015237.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]