SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Anas platyrhynchos 76_1.0 > ENSAPLP00000013500

Domain assignment for ENSAPLP00000013500 from Anas platyrhynchos 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSAPLP00000013500
Domain Number 1	Region: 29-265
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	6.29e-37
Family	Ankyrin repeat	0.00043
Further Details:

Domain Number 2	Region: 287-332
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.00000314
Family	SOCS box-like	0.0068
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSAPLP00000013500 Gene: ENSAPLG00000013688 Transcript: ENSAPLT00000014253
Sequence length	334
Comment	pep:known_by_projection scaffold:BGI_duck_1.0:KB743366.1:199801:207656:-1 gene:ENSAPLG00000013688 transcript:ENSAPLT00000014253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LPLGRTQPSCPVSSAGRNLKEWLREQFCDHPLEHCEDTRLHDAAYVGDLPTLKSLLQEES FQSRINEKSVWCCGWLPCTPLRIAATAGHGPCVDFLLRKGAEIDLVDVKGQTALYVAVVN GHLECAKILLEAGADPNGSRHHRSTPVYHAARVGRADILRELIRYGADVDVNHHLASRVS SLSLRPLTTLVVCPLYISAAYHNLQCFRLLLQAGANPDFNCCGPINIQGFSRGSPVCVMD AVLRHGCDAAFIHLLIDFGANLNLVKVEALEFDSTGRVKVNPEALQIFKEARGRARSLLS LCRIAVRRILGKSRLDLIHILPVPDPIKQFLLHE
Download sequence
Identical sequences	U3J1X3 ENSAPLP00000013500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]