SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013537 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013537
Domain Number 1 Region: 336-605
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.85e-86
Family Eukaryotic proteases 0.0000000195
Further Details:      
 
Domain Number 2 Region: 104-198
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-30
Family Kringle modules 0.0000464
Further Details:      
 
Domain Number 3 Region: 204-289
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-25
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 4 Region: 45-106
Classification Level Classification E-value
Superfamily GLA-domain 5.21e-20
Family GLA-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013537   Gene: ENSAPLG00000013716   Transcript: ENSAPLT00000014291
Sequence length 609
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742689.1:273465:283457:-1 gene:ENSAPLG00000013716 transcript:ENSAPLT00000014291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHSKTSILQGLLLSSLLHLTLSHDGVFLEKGQALSLLKRPRRANKGFLEEMLKGNLERE
CLEEICSYEEAFEALESTVDTNVFWPKYQACQGMRKTRTALDACLEGNCSAGLGQNYQGT
ISYTKSGIECQVWTSKYPHIPKFNATIYPNLIENYCRNPDNNSEGPWCYTRDPTVEREEC
PIPVCGQDRTTVEFTPRVTTTAPVQACEPERGMLYTGTLSVTVSGAKCLPWNSEKAKALL
QNKDITPEVKLLENYCRNPDADEEGVWCVTDEPPYFEYCDLNYCDSLLEDEYEQQEERGG
RTLLPQEFQTFFDDATFGTGEADCGTRPLFEKKKLTDKSEKELLESYIGGRVVHGDDAEL
GSSPWQVMLYKKSPQELLCGASLISSNWVLTAAHCLFYPPWDKNLTTDDILVRIGKHFRA
KYEKNKEKIALLDKIILHPKYNWKENMDRDIALLHLKRPIAFSDYIHPVCLPTKEVVQRL
MLAGYKGRVTGWGNLKETWVTSPNNLPTVLQQLNIPIVDQDTCKASTRVKVTDNMFCAGY
SPEDSKRGDACEGDSGGPFVMKNPDDNRWYQVGIVSWGEGCDRDGKYGFYTHVFRLKKWM
RKAIEKHRG
Download sequence
Identical sequences U3J210
ENSAPLP00000013537 XP_005014005.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]