SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013565 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013565
Domain Number 1 Region: 43-171
Classification Level Classification E-value
Superfamily TPR-like 2.71e-19
Family Tetratricopeptide repeat (TPR) 0.0054
Further Details:      
 
Domain Number 2 Region: 848-887
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000754
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 771-803
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00001
Family CCCH zinc finger 0.0056
Further Details:      
 
Domain Number 4 Region: 906-934
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000612
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000013565
Domain Number - Region: 631-662
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0137
Family CCCH zinc finger 0.0072
Further Details:      
 
Domain Number - Region: 506-535
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0608
Family CCCH zinc finger 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013565   Gene: ENSAPLG00000013636   Transcript: ENSAPLT00000014323
Sequence length 973
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744498.1:58047:79785:-1 gene:ENSAPLG00000013636 transcript:ENSAPLT00000014323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVSEERSTRQQDIKKGLQFIESTLPYPGTQEQYELFIRELVRNLFNEGNDVYREGDWR
GSLSHYTEAINIADYANSEEIHVSDDILEKLHVNRIACFSNMGLHEKVLEDCEIALRLNE
NNFRALYRKAKALNELGRYKKAYDAVAKCSLAVPQDESVIKLTQELAQKLGLKIRKAYVR
AKPPSSNSVSSDILNLSSSSSVEDIEFDLSDQKQEMVSAASSSVFVSELSKVASVPLSSL
SSVMSLQVEKVSLPSAVLANGGNVSFSMPEACLDCGDGDIIIGEELDELLDSVPDPDESV
MQTTGARGPIPAGSVAPSVPFSASLLGTLPVSTGFVPSPSLSEIFSQPLASSLENFCSPL
STFSISDPKRDLSSSASRDGTPTLNSNNSPLFINGPSSLFGSENYVGIAGQARNEFSNVF
SSATANVPVSSVLAGRNPLEGTHELRQACQLCFVKKGPKLLDYAYHPNLEHKCKKDILIG
RIKNSEDKSWKKIRPRPTKTQYVGPYYICKDVAAEEECRYPGHCTFAYCQEEIDVWTLER
KGAFSREALFGGNGKINFTVSRLLQEHHGLFMFLCEKCFDHKPRIISKRNKDNSSSCSHP
AMHDFEDNKCLVHILRETMVKYSKIRPFQVRCQLDLCRHEVHYGCLREDKCFYAHSLVEL
KVWIMQKETGISHDAIVQESKKYWQNMEASTHGSQILGNQMKYGSLNLKIKFVCGQCWRN
GQVNEPDRNKKYCSAKARHPWTKDRRVVLVMSNERKKWMTIRPLPAKKQVPLQFDLCNHI
ASGKKCQYDGNCSFAHSPEEREMWTYMKENSIQDLEQLYDIWLKSQKQEKGDDTAAQANK
ENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQNCWQYR
FPTGYFSICDRYMAGTCTEGNNCKFAHGNAELHEWEERRQVLRMKLSKARKDHLIAPSDN
DFGKYSFLFKDLN
Download sequence
Identical sequences U3J238
ENSAPLP00000013565 XP_012963304.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]