SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000013835 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000013835
Domain Number 1 Region: 180-409
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-57
Family Voltage-gated potassium channels 0.00074
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 2.75e-32
Family Tetramerization domain of potassium channels 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000013835   Gene: ENSAPLG00000013982   Transcript: ENSAPLT00000014601
Sequence length 658
Comment pep:novel scaffold:BGI_duck_1.0:KB742677.1:125662:230967:-1 gene:ENSAPLG00000013982 transcript:ENSAPLT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPTEKNKRQDELIILNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCILNFYRTGKLHYPRYECISAYDEELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQEGSMPSLSFRQTMWRAFENPHTS
TLALVFYYVTGFFIAVSVITNVVETVPCGTVPGNKELPCGERYAVAFFCLDTACVMIFTV
EYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFK
FSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFW
YTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKR
RAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGSTEDEQHMTKGTSLIESQHHH
LLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQLFEQNCMESSMQNYPSSRSPSLSS
HHGLTTSCCSRRNKKTTHLPNSSVPATRLRSMQELSTIHIQCSEQPSLTTSRSSLNMKSD
DGLRPNCKAAQITTAIISIPTPPALTPEGESRPPPSSPGHSTNISTTTTSNIVKVSAL
Download sequence
Identical sequences R0K771
XP_005013735.1.99704 XP_013045158.1.65836 XP_013045159.1.65836 ENSAPLP00000013835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]