SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000014527 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000014527
Domain Number 1 Region: 127-227
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 2 Region: 254-321
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00057
Further Details:      
 
Domain Number 3 Region: 2-101
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-23
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000014527   Gene: ENSAPLG00000014685   Transcript: ENSAPLT00000015306
Sequence length 321
Comment pep:novel scaffold:BGI_duck_1.0:KB743226.1:2156080:2173058:1 gene:ENSAPLG00000014685 transcript:ENSAPLT00000015306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELSLTDGPDRCAGNVEIDYFGMSAKVCGFQWDMNDAQVVCRQLGCGSPVSVMEYFSSSDS
YPWYQRTAVACDGSESSLLFCPSDYVSSECQHGTASVICSERKGSSSTHVVDWGFPWLTI
SLPFQELELRLTDGPNRCAGNVEIDYFGMSAKVCGFQWDMNDAQVVCRQLGCGSPVSVME
HFPSRDSYPWYQRTAVACDGSESSLLFCPFDYVSSDCDHGAASVICSVPDSPSSTPTVPQ
LQFPQIDFGTKSGVSLSLVNGRNRCEGRIEIYQYGNRGTVCDDGWDLSDAQVVCRQLGCG
YAVSAFGSAYFGQGSGSIYLD
Download sequence
Identical sequences U3J4V0
ENSAPLP00000014527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]