SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015022 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015022
Domain Number 1 Region: 212-460
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-49
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 58-166
Classification Level Classification E-value
Superfamily POZ domain 1.7e-28
Family Tetramerization domain of potassium channels 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015022   Gene: ENSAPLG00000015168   Transcript: ENSAPLT00000015812
Sequence length 517
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743230.1:144593:165119:1 gene:ENSAPLG00000015168 transcript:ENSAPLT00000015812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLTGNADPAFSSYSFNNLESLCEVQTKKGLFYKKAKLLHPGEDLCCLARLDDRTRFVI
INVGGIKYKIPWTTLENCPLTRLGKLKSCNNYDEIMNICDDYDVSCNEFFFDRNPCAFRT
IMTFLTAGKLRLLREMCALSFQEELVYWGIEEDHLEWCCKKRLRQKEEEAAEARLYEGEM
VFSETTQCAFQDNSRLSLCMRKLRDMVENPHSGIPGKIFACISISFVAITAVSLCISTMP
DVREEEDRGECSQKCYNIFVLETVCVAWFSFEFLLRSIQAENKCAFLKTPLNIIDILAIL
PFYISLIVDMVSTKNSSKPGGGAGNKYLERERVGLVLRFLRALRILYVMRLARHSLGLQT
LGLTVRRCTREFGLLLLFLCVAMALFSPLVYLAESELGAKQEFTSVPTSYWWAVISMTTV
GYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYSELKEQQQRAASRQMRQL
EESTKLTGGDSVASPLDAAREVGQPAVDQEAKRTRQE
Download sequence
Identical sequences U3J695
ENSAPLP00000015022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]