SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015300 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015300
Domain Number 1 Region: 448-620
Classification Level Classification E-value
Superfamily SPOC domain-like 1.14e-50
Family SPOC domain 0.00014
Further Details:      
 
Domain Number 2 Region: 30-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.4e-28
Family Canonical RBD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015300   Gene: ENSAPLG00000015455   Transcript: ENSAPLT00000016095
Sequence length 622
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745055.1:82645:85292:1 gene:ENSAPLG00000015455 transcript:ENSAPLT00000016095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAAGGFRGGGGGAGAASEEEISPEDDQRANRTLFLGNLDITVSETDLRRAFDRFGVITEV
DIKRPGRGQTSTYGFLKFENLDMAHRAKLAMSGKVLLRNPIKIGYGKATPTTRLWVGGLG
PWVPLAALAREFDRFGTIRTIDYRKGDSWAYIQYESLDAAQAACAHMRGFPLGGPDRRLR
VDFADTEHRYQQPYLQPLPLPPPAHYELVAEAAAFGAHRGAPPDPLRGARDRTPPLLYRD
RDRDLYPETEWVPPPPPVRDRSNRAAAYDPLESLERRRDGWSLERDRGERELGSSSREQP
RKRRLAEDGGRHLDRSPDSERSSSSRKRHCLATTSPPDRSPELLGGRERYSSDPERSSSR
LLLLERPSPIRESRRGSLERGQNEKRDRKNSAERERKHRASAAAAAQECKSPAKKDERAA
EGGGGGSRLKPPPQKQQQDGASQAGGASKLCLAWQGMLLLKNSNFPSNMHLLQGDLGVAS
SLLVEGATGGKVAQLKITQRLRLDQPKLDEVNRRIKVAGPNGYAILLAVPGTSDNRSATG
ASEAATTSTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENSGVLHAFPPCDFSQQFLDS
TAKALAKSEDDYLVMIIVRGAS
Download sequence
Identical sequences U3J723
ENSAPLP00000015300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]