SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015335 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015335
Domain Number 1 Region: 125-208
Classification Level Classification E-value
Superfamily E set domains 3.92e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015335   Gene: ENSAPLG00000015476   Transcript: ENSAPLT00000016130
Sequence length 454
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744300.1:122627:380871:-1 gene:ENSAPLG00000015476 transcript:ENSAPLT00000016130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQN
CLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYL
EHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPR
HIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEV
ILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVN
SFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGNAGMS
NLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSA
FAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences A0A091EFU3 A0A091V5K2 A0A093HVM5 A0A0A0A162 G1N055 U3J758
ENSAPLP00000015335 ENSMGAP00000004755 ENSMGAP00000004755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]