SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015612 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015612
Domain Number 1 Region: 185-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-59
Family Voltage-gated potassium channels 0.0007
Further Details:      
 
Domain Number 2 Region: 31-140
Classification Level Classification E-value
Superfamily POZ domain 1.75e-31
Family Tetramerization domain of potassium channels 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015612   Gene: ENSAPLG00000015753   Transcript: ENSAPLT00000016413
Sequence length 854
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742697.1:401412:515836:1 gene:ENSAPLG00000015753 transcript:ENSAPLT00000016413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLGMNKHGSRSTTSLPPDPTEIVRSKACSRRVKLNVGGLAHEVLWRTLDRLPRTRLGKL
RDCNTHDSLMEICDDYNLEENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELD
YWGVDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCADKRKKLWDLLE
KPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQGVDEFGQTTDNPQLAHVEAVCIAWF
TMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFR
IMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTK
FKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIELMDIVVEKNGESIAKKDKVQD
NHLSPSKWKWTKRTLSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYNKMAKTQ
SQPNLNTKESNQPGKQKEELEMEALPGPMVPLLTTRADGIIDMRSMSSIDSFISCAAEFP
DSGRFSHSPLATLPCKGGINVIQEQSRGEGSGARFVEINPSSEGSHRSAFFIESPKSSIK
ASNPLKLRSLKVNFMEEDTSTLVPASNVLRIYPDTLKGRGAAAAATDTSLLSDRSLMSPE
TSIYTTASARTPPKSPETQTAIAFNFHDAGIHKYIDADTDDEGQLLYDSSPPGNVSPKYN
QKDNVYRTEKNHLEAAALPTSPKLIGQNCIYSMEGITGRTQGHQETVRLENHISPEVHVL
PGSGGHANTHDQSI
Download sequence
Identical sequences U3J7Y4
ENSAPLP00000015612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]