SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000015705 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000015705
Domain Number 1 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 525-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 273-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 217-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 105-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-23
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 581-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 10 Region: 637-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 11 Region: 66-118
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 12 Region: 678-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 13 Region: 1-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000824
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 14 Region: 487-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000182
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000015705   Gene: ENSAPLG00000015838   Transcript: ENSAPLT00000016506
Sequence length 735
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB746338.1:4643:22732:-1 gene:ENSAPLG00000015838 transcript:ENSAPLT00000016506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTKEQWVLLDPVQRTLYMDVMLENYETVTLLGFPAAEPDLLTQEGGEAPNLQEMEKKPPR
DDVGEKPFKCPECGRSFMRSSDLIVHQRTHTGEKPYQCPECGRCFNRSSSLVTHQRVHTG
EKMYKCPECAKSFTRSSTLTAHQRTHTGEKPYQCCECGKSFSKRSNLIKHQRQHTGERPY
RCPDCGKSFIQSSDLIVHQRTHTGEKPYQCSVCGKCFSVRSKLIQHQRVHTGEKPYTCAE
CGKSFGQSSHLSVHERVHTGEKPYKCHECGKRFTRSSDIVVHQRIHTGEKPFECSECGKR
FSQRSNLFTHRIVHTGEKPFECHECGKSFARRSELTIHQRTHTEEKPYQCSQCEKSFRGR
YGLFRHERLHTGEKPYECSECGKSFGQSGDLITHQRFHTGEKPYQCGECGKFFCNKSSLV
KHQKWHSGEKPYKCHECGKSFGQSSDLIAHQRTHTGEKPYPCAECGKRFTRKSSLLVHQR
THTGEKPYACCACGKPFSDRSNLAKHEMVHTGEKPYECHECEKRFARKSDLTVHQRIHTG
EKPFACAECGKSFNHKSNLFTHQRRHTGEKPFQCQECGKNFGHRTDLLVHQRTHTGEKPF
RCSECGKCFKGRTTLMRHERQHTGERPYTCPECGKSFGLSADLVVHQRFHTGEKPYKCGE
CGNFFCNSSSLVRHQRKHTGEKPYKCHECEKSFAQSTDLLEHRTTHTGEKPYPCQQCGKC
FGRKSNLIVHQRVHG
Download sequence
Identical sequences U3J877
ENSAPLP00000015705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]