SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016065 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016065
Domain Number 1 Region: 120-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.3e-28
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 2 Region: 229-374
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-28
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 3 Region: 17-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-18
Family First domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016065   Gene: ENSAPLG00000016171   Transcript: ENSAPLT00000016877
Sequence length 633
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742905.1:218694:248333:1 gene:ENSAPLG00000016171 transcript:ENSAPLT00000016877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMELTFHLPGRMQPEGRSVCVFLPDREQLSLTVGVKATGQELFQQVCDLVKIKEPHFFGL
SIVKNNEYVFIDLEQKLSKYFSKEWKKETNKISKLKAVWGGTEKFSPPFVAFFRVQYYVE
NGRVISDKVARQLYYCHLKEQVLMSRCNHKEEIYFLLAAYSLQADLGNYREEVHTGKYFE
PQAYFPQWIIAKRGSDYILKHAPEMHREQQGLSAKEAVLKFIKESCLLEDVPVHFYRLQK
DKKEDRPTVILGLTLRGMHIYQEVNHVRQLLYDFPWSHIGKLAFLGKKFEIQPDGLPSAR
KLVYYTGCPFRSRHLLQLLSNSHRLFLNIQPVLKQIQKLEEAEEKKRYRESYISDTLDMD
LDPCDKNSRGSGSSVGSRRDNRLSRQSTGSHGSSHTSGIEADSRHRVSVEMSVDEPFSID
RVHRKEKSCSSTISYGSSGIDSGSKGRAEDDSQDDDLELAVDEPEEVPVDEPLGRDQLEE
ATVSCLALRHNRLRSKSRWANTGEVGEKLFSSVNQESLSVVQVTLIKMRGQSVESLHQVK
SPRGRSCTDQHSQSLDDIRLYKHRHPPLSATLSSDTSHSYTFGCSLEDKLSVYGCVYSTA
DCKTKSALYGKRSMNCLSLDLLGEDQLPEEFVV
Download sequence
Identical sequences U3J987
ENSAPLP00000016065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]