SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000016066 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000016066
Domain Number 1 Region: 235-484
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.85e-86
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 138-240
Classification Level Classification E-value
Superfamily SRCR-like 1.23e-16
Family Hepsin, N-terminal domain 0.075
Further Details:      
 
Domain Number 3 Region: 105-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000016066   Gene: ENSAPLG00000016160   Transcript: ENSAPLT00000016878
Sequence length 486
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743889.1:64697:76866:-1 gene:ENSAPLG00000016160 transcript:ENSAPLT00000016878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALTAGSFPGPPPYFENHGFQPENYSARPPAGANPYPPYFSTNAPSVPTYVPRVSTYQST
SPVAPSTGRTCSSGVKKTIIIVISILIVICCAVGAFFIWYFVENPCLGSLECGSSGVCVP
PSDWCDGVTNCPNGEDENRCVRLFGPNFILEVYSPVSNTWYPVCQDNWTDDFGKIACKDI
GYNVDTYYSSSGVAAEVSFKSFMKLNTSAGSTDLYKRLYTSNVCTSGKVVSLRCIQCGLS
TKSTAIMNRIVGGSAAALGQWPWQLSLHVQGTHVCGGSIITREWLVTAAHCVEGQLSDPY
VWRVYAGIVSQSDITLRAAYKVQQIISHPDYDTDTKDNDVALMKLETPLSFTDNVQPVCL
PNAGMTFQPNQQCWISGWGAESQGGKTSTNLNYVMVPLIERSKCNSIYIYNGLILPTMIC
AGYLEGGIDSCQGDSGGPLVTNESSVWWLVGDTSWGSGCATPNRPGVYGNMTVFTDWIYK
NMQANR
Download sequence
Identical sequences U3J988
ENSAPLP00000016066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]