SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291279301|ref|YP_003496136.1| from Deferribacter desulfuricans SSM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291279301|ref|YP_003496136.1|
Domain Number 1 Region: 42-215
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.44e-34
Family Glutathione peroxidase-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291279301|ref|YP_003496136.1|
Sequence length 215
Comment AhpC/Tsa family protein [Deferribacter desulfuricans SSM1]
Sequence
MTLKEIIENFKKERLSQLPDNVKVIMMKATEDLINSGIEEQLPKVGEKIFDFTLPNYDGK
EVRLGELLEDGPVVLNFYRGGWCPYCNLQLNYLQSRLDDFKKYGTVLVAVLPELPNMAAS
TVDRHSIKFYVLLDMDNKVAKRLGLVFKLPDEVVSIYKKLGHDLEKYNGNDKYEIPVPAT
FVIDKDFTIRYSFGKADYTQRAEPDDIIEVLKTLQ
Download sequence
Identical sequences D3PCQ7
WP_013007627.1.2578 gi|291279301|ref|YP_003496136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]