SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291279649|ref|YP_003496484.1| from Deferribacter desulfuricans SSM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291279649|ref|YP_003496484.1|
Domain Number 1 Region: 132-332
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 1.7e-56
Family Nqo1 FMN-binding domain-like 0.00000612
Further Details:      
 
Domain Number 2 Region: 418-492
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 0.000000000000235
Family Nqo1C-terminal domain-like 0.0044
Further Details:      
 
Domain Number 3 Region: 32-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000145
Family NQO2-like 0.02
Further Details:      
 
Domain Number 4 Region: 340-394
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 0.000017
Family Nqo1 middle domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291279649|ref|YP_003496484.1|
Sequence length 495
Comment NADH dehydrogenase I, F subunit [Deferribacter desulfuricans SSM1]
Sequence
MPVVDRYKRNFAFIKDRFVYKNFLEEAKRYKFSSIDKKTIKLLARKFGIPYSETFSIVSF
YSLLNVNGKNLLSCNAPCCKNDELFDNAIKTHCLGLCDNSPAVIKEGKQACFVQGIFKES
ESAKVLNKNIDDCFILNVRDKDEYITTLTKLLSADRDDLLERVKKSDLRGRGGANFPTYK
KFEAIKNINSSKKYLVCNIDESEPFVFKDRALLEINPFVAVAGAILSAYIVGATDIIFYI
RGEYIKQKKILSEITSYFLLEIDFFNSLNVEIVSGAGAYVCGEETGLIESFEGKRGNPRN
KPPYPFESGIFGKPTLVNNIETLSYVFEVCEKKIVNLNKRLISVCGDVKEKGVVEIDLDV
AINEIVKNICDRTIGNPGFAILGGASGFFVDKNNFSKKLRDFEKSFVGSIFIADESRDKL
SILKYFVSFFADESCGQCIPCYKGYQKLEEILSINNLNDKVEDIKSIVESMSVSTRCGLG
KAIKNGVYSFFESAK
Download sequence
Identical sequences D3PDQ5
gi|291279649|ref|YP_003496484.1| WP_013007975.1.2578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]