SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291279819|ref|YP_003496654.1| from Deferribacter desulfuricans SSM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291279819|ref|YP_003496654.1|
Domain Number 1 Region: 176-499
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.38e-31
Family Cellulases catalytic domain 0.083
Further Details:      
 
Domain Number 2 Region: 26-149
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000174
Family Thioltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291279819|ref|YP_003496654.1|
Sequence length 631
Comment hypothetical protein DEFDS_1438 [Deferribacter desulfuricans SSM1]
Sequence
MEFLISLLILFQILHFGEIKINRLFLSNSSYLKQHQTNPVNWHFFNSYSLFLSKYTNKPL
FISIGFKSCHWCNELEKELFKKSDAANFLNKKFIPVKIDKEEMPQIDNYFQSYYFKIYGK
NAGWPLNIISDYKLKPKAFFSFVPYKDEFTGKSYKKIILEKLNEDITIKTKNHQTLQISK
VFDQKYGGFLVDGLLKFPRNEIYQLLADRYIYEHNINDKEIATLSLYNMASKGLFDIIDG
GFFRYSTDTEWIIPHFEKMLYTNALLISTYLRWYSITNNKFYLNTVKKTLSFWLNNMYNG
KYFYSSINADSNDMEGQYYLIDYRKLQDYLKNNYPNIDIKTFEKLHITKDGNFDYFLNQP
YLSDYELDNKTRYLINILQTYRLKKPFPQIDKQIIFSWNMEMLKALIDYSYFDRKILNFI
IKTLFNLEKDFIYHNNIFHSKNLNTLNTNSLLEDYAFYIETLIALYNRTLNKDFFYKAIK
FTNIAINKFYKNGNWYTTESHKFIASLNEKYKKSAALTMLLNLKYILPISNKDLFIKVYK
ETYENISKLRLDSINNPSFYRLRFPTIKITGNRKNLNLLIDNKLPLKYHLIFKETQDKYL
YLTACYNKICFIHTKSPYELIKIINNKINNN
Download sequence
Identical sequences D3PE75
WP_013008144.1.2578 gi|291279819|ref|YP_003496654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]