SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291280352|ref|YP_003497187.1| from Deferribacter desulfuricans SSM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291280352|ref|YP_003497187.1|
Domain Number 1 Region: 112-352
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 4.05e-95
Family Nqo1 FMN-binding domain-like 0.0000000687
Further Details:      
 
Domain Number 2 Region: 438-538
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 1.2e-37
Family Nqo1C-terminal domain-like 0.00057
Further Details:      
 
Domain Number 3 Region: 353-436
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 1.16e-25
Family Nqo1 middle domain-like 0.00036
Further Details:      
 
Domain Number 4 Region: 543-596
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.19e-17
Family Ferredoxin domains from multidomain proteins 0.048
Further Details:      
 
Domain Number 5 Region: 9-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000224
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291280352|ref|YP_003497187.1|
Sequence length 596
Comment NADH-quinone oxidoreductase subunit F [Deferribacter desulfuricans SSM1]
Sequence
MSAQNLDRIEVHVCMGTAGVASGGAEVMAAFEEEFKKHGLIGEVKERNCKVKATGCRGLC
ARDVLVDIHIPGQEEVTYEHVTPEIVPTIVEEHILKGEVVKKWAAKKDYYDFYKLQKRYV
LADCGKVDPEDIDDYIAHGGYEAIKKVLKEMTPEEVIEEVKKSGLRGRGGGGFPTGLKWT
FCRASKGDLKYLICNADEGDPGAFMDRSIIEGNPHVVIEGMLIAAYAIGCKEGYIYCRAE
YPLAIKRVKKALKIAEERGFLGKNILGTDFEFHLHLKEGAGAFVCGEETALIASIEGERG
MPRPRPPFPAVKGLWGKPSNVNNVETFANLPLIINNGADWYASIGTEKSKGTKIFALSGK
VKSTGLIEVPMGVTVRQLVFDVGGGIPKKRKIKAVQLGGPSGGCLPESLLDTPIDYDSLI
AAGAMMGSGGVVVMDETNCMVNVAKFFLTFTQRESCGKCIPCRIGTKTMLDILERICAGE
GREGDIELLESLAMDIKTASLCGLGQTAPNPVLTTIKYFRHEYEAHIKDRKCPARECPEL
IEFVVDEDRCKKCGICFKVCPVGAISWEKGKPAYIDKSKCVKCRECIVNCPFNAID
Download sequence
Identical sequences D3P9P1
WP_013008676.1.2578 gi|291280352|ref|YP_003497187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]