SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291280395|ref|YP_003497230.1| from Deferribacter desulfuricans SSM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291280395|ref|YP_003497230.1|
Domain Number 1 Region: 21-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000114
Family Thioltransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291280395|ref|YP_003497230.1|
Sequence length 80
Comment hypothetical protein DEFDS_2024 [Deferribacter desulfuricans SSM1]
Sequence
MIKVEFFYNGSKDTNTPEIAKNLAEKYRDKIEVILIDTEKEKIPEEYGILNPPVVIIDKK
KKIQLDSKENLDEIVTKAIF
Download sequence
Identical sequences D3P9T4
WP_013008719.1.2578 gi|291280395|ref|YP_003497230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]