SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283456460|ref|YP_003361024.1| from Bifidobacterium dentium Bd1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283456460|ref|YP_003361024.1|
Domain Number 1 Region: 66-439
Classification Level Classification E-value
Superfamily Serpins 5.89e-66
Family Serpins 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283456460|ref|YP_003361024.1|
Sequence length 441
Comment Neuroserpin precursor [Bifidobacterium dentium Bd1]
Sequence
MKRIDLRGTTIVTPKSAQRNKAGRRVIIAIIAAVLAIAIVVTGGFWYFAWDGRYTVADLF
RPKAVAASDAAVESSRSFAYESAVKFLAKQKNVNYSPASLQMALLVAAQGAKGDTLSQLQ
QALASEKLSDSDLTSIYRSIIGKRSGKSRLDAANSIWARRDLTLNKDYTDAVRRIFGTQV
KRVKAFDNDTNKAMSTWISDQTRGMLKPEIDTPKNNGMSILNTLYADGRWSDPFDKASTK
KSTFHTLQGSTSTIDFMHKTFETEQHADDVDAYTKGDGWQRVDLTFDNGGRMKILLPDNN
TRFKALRGDAAALRKAFSAKSNAQSDTEVNVSLPKFSIDSTFDSDSMIKAMQEMGVTDAF
NVDKADFSGMSDARMFIGAIVQGTRIEVTEAGAKAAAYTQIDMELAMMPVETVDFNVDRP
FLYEFDSPDGLPLFIGAVTEL
Download sequence
Identical sequences D2Q5I5
WP_003839325.1.11892 WP_003839325.1.14814 WP_003839325.1.2424 WP_003839325.1.39260 WP_003839325.1.91619 gi|283456460|ref|YP_003361024.1| 401473.BDP_1607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]